![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
![]() | Protein Hypothetical protein TM0436 [102124] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [102125] (1 PDB entry) |
![]() | Domain d1vj0b2: 1vj0 B:156-337 [100789] Other proteins in same PDB: d1vj0a1, d1vj0b1, d1vj0c1, d1vj0d1 structural genomics complexed with unl, zn |
PDB Entry: 1vj0 (more details), 2 Å
SCOPe Domain Sequences for d1vj0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vj0b2 c.2.1.1 (B:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} ddldvlamamcsgatayhafdeypesfagktvviqgagplglfgvviarslgaenvivia gspnrlklaeeigadltlnrretsveerrkaimdithgrgadfileatgdsrallegsel lrrggfysvagvavpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqlls kl
Timeline for d1vj0b2: