Lineage for d1vj0d1 (1vj0 D:3-155,D:338-367)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785771Protein Hypothetical protein TM0436 [101704] (1 species)
  7. 2785772Species Thermotoga maritima [TaxId:2336] [101705] (1 PDB entry)
  8. 2785776Domain d1vj0d1: 1vj0 D:3-155,D:338-367 [100792]
    Other proteins in same PDB: d1vj0a2, d1vj0b2, d1vj0c2, d1vj0d2
    structural genomics
    complexed with unl, zn

Details for d1vj0d1

PDB Entry: 1vj0 (more details), 2 Å

PDB Description: crystal structure of alcohol dehydrogenase (tm0436) from thermotoga maritima at 2.00 a resolution
PDB Compounds: (D:) alcohol dehydrogenase, zinc-containing

SCOPe Domain Sequences for d1vj0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vj0d1 b.35.1.2 (D:3-155,D:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]}
glkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvhmfrgedprvplpii
lghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckvskepylcpnrkvyg
inrgcseyphlrgcysshivldpetdvlkvsekXithrlplkeankalelmesrealkvi
lype

SCOPe Domain Coordinates for d1vj0d1:

Click to download the PDB-style file with coordinates for d1vj0d1.
(The format of our PDB-style files is described here.)

Timeline for d1vj0d1: