Lineage for d1vj0d2 (1vj0 D:156-337)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841298Protein Hypothetical protein TM0436 [102124] (1 species)
  7. 2841299Species Thermotoga maritima [TaxId:2336] [102125] (1 PDB entry)
  8. 2841303Domain d1vj0d2: 1vj0 D:156-337 [100793]
    Other proteins in same PDB: d1vj0a1, d1vj0b1, d1vj0c1, d1vj0d1
    structural genomics
    complexed with unl, zn

Details for d1vj0d2

PDB Entry: 1vj0 (more details), 2 Å

PDB Description: crystal structure of alcohol dehydrogenase (tm0436) from thermotoga maritima at 2.00 a resolution
PDB Compounds: (D:) alcohol dehydrogenase, zinc-containing

SCOPe Domain Sequences for d1vj0d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vj0d2 c.2.1.1 (D:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]}
ddldvlamamcsgatayhafdeypesfagktvviqgagplglfgvviarslgaenvivia
gspnrlklaeeigadltlnrretsveerrkaimdithgrgadfileatgdsrallegsel
lrrggfysvagvavpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqlls
kl

SCOPe Domain Coordinates for d1vj0d2:

Click to download the PDB-style file with coordinates for d1vj0d2.
(The format of our PDB-style files is described here.)

Timeline for d1vj0d2: