| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
| Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
| Protein Hypothetical protein TM0436 [101704] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [101705] (1 PDB entry) |
| Domain d1vj0c1: 1vj0 C:4-155,C:338-367 [100790] Other proteins in same PDB: d1vj0a2, d1vj0b2, d1vj0c2, d1vj0d2 structural genomics complexed with unl, zn |
PDB Entry: 1vj0 (more details), 2 Å
SCOPe Domain Sequences for d1vj0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vj0c1 b.35.1.2 (C:4-155,C:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]}
lkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvhmfrgedprvplpiil
ghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckvskepylcpnrkvygi
nrgcseyphlrgcysshivldpetdvlkvsekXithrlplkeankalelmesrealkvil
ype
Timeline for d1vj0c1: