PDB entry 1vj0

View 1vj0 on RCSB PDB site
Description: Crystal structure of Alcohol dehydrogenase (TM0436) from Thermotoga maritima at 2.00 A resolution
Class: oxidoreductase
Keywords: TM0436, ALCOHOL DEHYDROGENASE, ZINC-CONTAINING, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2003-12-02, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase, zinc-containing
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vj0a1, d1vj0a2
  • Chain 'B':
    Compound: alcohol dehydrogenase, zinc-containing
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vj0b1, d1vj0b2
  • Chain 'C':
    Compound: alcohol dehydrogenase, zinc-containing
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vj0c1, d1vj0c2
  • Chain 'D':
    Compound: alcohol dehydrogenase, zinc-containing
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vj0d1, d1vj0d2
  • Heterogens: ZN, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vj0A (A:)
    mgsdkihhhhhhmmglkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvh
    mfrgedprvplpiilghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckv
    skepylcpnrkvyginrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsg
    atayhafdeypesfagktvviqgagplglfgvviarslgaenviviagspnrlklaeeig
    adltlnrretsveerrkaimdithgrgadfileatgdsrallegsellrrggfysvagva
    vpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkean
    kalelmesrealkvilypeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj0A (A:)
    mglkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvhmfrgedprvplpi
    ilghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckvskepylcpnrkvy
    ginrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsgatayhafdeypes
    fagktvviqgagplglfgvviarslgaenviviagspnrlklaeeigadltlnrretsve
    errkaimdithgrgadfileatgdsrallegsellrrggfysvagvavpqdpvpfkvyew
    lvlknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkeankalelmesrealk
    vilype
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vj0B (B:)
    mgsdkihhhhhhmmglkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvh
    mfrgedprvplpiilghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckv
    skepylcpnrkvyginrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsg
    atayhafdeypesfagktvviqgagplglfgvviarslgaenviviagspnrlklaeeig
    adltlnrretsveerrkaimdithgrgadfileatgdsrallegsellrrggfysvagva
    vpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkean
    kalelmesrealkvilypeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj0B (B:)
    lkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvhmfrgedprvplpiil
    ghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckvskepylcpnrkvygi
    nrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsgatayhafdeypesfa
    gktvviqgagplglfgvviarslgaenviviagspnrlklaeeigadltlnrretsveer
    rkaimdithgrgadfileatgdsrallegsellrrggfysvagvavpqdpvpfkvyewlv
    lknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkeankalelmesrealkvi
    lype
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vj0C (C:)
    mgsdkihhhhhhmmglkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvh
    mfrgedprvplpiilghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckv
    skepylcpnrkvyginrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsg
    atayhafdeypesfagktvviqgagplglfgvviarslgaenviviagspnrlklaeeig
    adltlnrretsveerrkaimdithgrgadfileatgdsrallegsellrrggfysvagva
    vpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkean
    kalelmesrealkvilypeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj0C (C:)
    lkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvhmfrgedprvplpiil
    ghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckvskepylcpnrkvygi
    nrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsgatayhafdeypesfa
    gktvviqgagplglfgvviarslgaenviviagspnrlklaeeigadltlnrretsveer
    rkaimdithgrgadfileatgdsrallegsellrrggfysvagvavpqdpvpfkvyewlv
    lknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkeankalelmesrealkvi
    lype
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vj0D (D:)
    mgsdkihhhhhhmmglkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvh
    mfrgedprvplpiilghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckv
    skepylcpnrkvyginrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsg
    atayhafdeypesfagktvviqgagplglfgvviarslgaenviviagspnrlklaeeig
    adltlnrretsveerrkaimdithgrgadfileatgdsrallegsellrrggfysvagva
    vpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkean
    kalelmesrealkvilypeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj0D (D:)
    glkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvhmfrgedprvplpii
    lghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckvskepylcpnrkvyg
    inrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsgatayhafdeypesf
    agktvviqgagplglfgvviarslgaenviviagspnrlklaeeigadltlnrretsvee
    rrkaimdithgrgadfileatgdsrallegsellrrggfysvagvavpqdpvpfkvyewl
    vlknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkeankalelmesrealkv
    ilype