Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.20: RpiR-like [158263] (1 protein) Pfam PF01418; contains two extra helices, one at each termini; overall arrangment of five helices is similar to the helical core of the lambda integrase-like catalytic domain (56350) |
Protein Putative transcriptional regulator YbbH [158264] (1 species) |
Species Bacillus subtilis [TaxId:1423] [158265] (1 PDB entry) Uniprot Q45581 1-83 |
Domain d2o3fa1: 2o3f A:1-83 [148573] complexed with so4 |
PDB Entry: 2o3f (more details), 1.75 Å
SCOPe Domain Sequences for d2o3fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} matgglaiiqsmkhklppserkladyilahphkaiestvneisalanssdaavirlcksl glkgfqdlkmrvagdlakptfqg
Timeline for d2o3fa1: