SCOPe 2.08: Domain d2o3fc_: 2o3f C:

Lineage for d2o3fc_ (2o3f C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.20: RpiR-like [158263] (1 protein)
   Pfam PF01418; contains two extra helices, one at each termini; overall arrangment of five helices is similar to the helical core of the lambda integrase-like catalytic domain (56350)

6. Protein Putative transcriptional regulator YbbH [158264] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [158265] (1 PDB entry)
   Uniprot Q45581 1-83

8. Domain d2o3fc_: 2o3f C: [148575]
   automated match to d2o3fa1
   complexed with so4

Details for d2o3fc_

PDB Entry: 2o3f, 1.75 Å

PDB Description: Structural Genomics, the crystal structure of the N-terminal domain of the putative transcriptional regulator ybbH from Bacillus subtilis subsp. subtilis str. 168.

PDB Compounds: (C:) Putative HTH-type transcriptional regulator ybbH

SCOPe Domain Sequences for d2o3fc_:

Sequence; same for both SEQRES and ATOM records:

>d2o3fc_ a.4.1.20 (C:) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]}
matgglaiiqsmkhklppserkladyilahphkaiestvneisalanssdaavirlcksl
glkgfqdlkmrvagdlakptfqg

Timeline for d2o3fc_:

• d2o3fc_ first appeared in SCOP 1.75, called d2o3fc1
  
• d2o3fc_ appears in SCOPe 2.07