Lineage for d2o3fc_ (2o3f C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692700Family a.4.1.20: RpiR-like [158263] (1 protein)
    Pfam PF01418; contains two extra helices, one at each termini; overall arrangment of five helices is similar to the helical core of the lambda integrase-like catalytic domain (56350)
  6. 2692701Protein Putative transcriptional regulator YbbH [158264] (1 species)
  7. 2692702Species Bacillus subtilis [TaxId:1423] [158265] (1 PDB entry)
    Uniprot Q45581 1-83
  8. 2692705Domain d2o3fc_: 2o3f C: [148575]
    automated match to d2o3fa1
    complexed with so4

Details for d2o3fc_

PDB Entry: 2o3f (more details), 1.75 Å

PDB Description: Structural Genomics, the crystal structure of the N-terminal domain of the putative transcriptional regulator ybbH from Bacillus subtilis subsp. subtilis str. 168.
PDB Compounds: (C:) Putative HTH-type transcriptional regulator ybbH

SCOPe Domain Sequences for d2o3fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o3fc_ a.4.1.20 (C:) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]}
matgglaiiqsmkhklppserkladyilahphkaiestvneisalanssdaavirlcksl
glkgfqdlkmrvagdlakptfqg

SCOPe Domain Coordinates for d2o3fc_:

Click to download the PDB-style file with coordinates for d2o3fc_.
(The format of our PDB-style files is described here.)

Timeline for d2o3fc_: