PDB entry 2o3f

View 2o3f on RCSB PDB site
Description: Structural Genomics, the crystal structure of the N-terminal domain of the putative transcriptional regulator ybbH from Bacillus subtilis subsp. subtilis str. 168.
Class: transcription
Keywords: APC85504, putative transcriptional regulator ybbH, Bacillus subtilis subsp. subtilis str. 168, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG
Deposited on 2006-12-01, released 2007-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.183
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative HTH-type transcriptional regulator ybbH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ybbH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45581 (3-End)
      • modified residue (3)
      • modified residue (14-15)
      • modified residue (17)
      • modified residue (35)
      • modified residue (60)
      • modified residue (71-72)
    Domains in SCOPe 2.07: d2o3fa1
  • Chain 'B':
    Compound: Putative HTH-type transcriptional regulator ybbH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ybbH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45581
      • modified residue (14-15)
      • modified residue (17)
      • modified residue (35)
      • modified residue (60)
      • modified residue (71-72)
    Domains in SCOPe 2.07: d2o3fb_
  • Chain 'C':
    Compound: Putative HTH-type transcriptional regulator ybbH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ybbH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45581 (3-End)
      • modified residue (3)
      • modified residue (14-15)
      • modified residue (17)
      • modified residue (35)
      • modified residue (60)
      • modified residue (71-72)
    Domains in SCOPe 2.07: d2o3fc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o3fA (A:)
    snamatgglaiiqsmkhklppserkladyilahphkaiestvneisalanssdaavirlc
    kslglkgfqdlkmrvagdlakptfqgyrdivpheplpsisektagnaiqai
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o3fA (A:)
    matgglaiiqsmkhklppserkladyilahphkaiestvneisalanssdaavirlcksl
    glkgfqdlkmrvagdlakptfqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o3fB (B:)
    snamatgglaiiqsmkhklppserkladyilahphkaiestvneisalanssdaavirlc
    kslglkgfqdlkmrvagdlakptfqgyrdivpheplpsisektagnaiqai
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o3fB (B:)
    atgglaiiqsmkhklppserkladyilahphkaiestvneisalanssdaavirlckslg
    lkgfqdlkmrvagdlakptfqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2o3fC (C:)
    snamatgglaiiqsmkhklppserkladyilahphkaiestvneisalanssdaavirlc
    kslglkgfqdlkmrvagdlakptfqgyrdivpheplpsisektagnaiqai
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o3fC (C:)
    matgglaiiqsmkhklppserkladyilahphkaiestvneisalanssdaavirlcksl
    glkgfqdlkmrvagdlakptfqg