SCOPe 2.08: Domain d1xw6a1: 1xw6 A:85-217

Lineage for d1xw6a1 (1xw6 A:85-217)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
Protein Class mu GST [81348] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [47622] (17 PDB entries)
Uniprot P09488 P28161
Domain d1xw6a1: 1xw6 A:85-217 [116103]
Other proteins in same PDB: d1xw6a2, d1xw6b2, d1xw6c2, d1xw6d2
complexed with gsh

Details for d1xw6a1

PDB Entry: 1xw6 (more details), 1.9 Å

PDB Description: 1.9 angstrom resolution structure of human glutathione s-transferase m1a-1a complexed with glutathione

PDB Compounds: (A:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d1xw6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xw6a1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOPe Domain Coordinates for d1xw6a1:

Click to download the PDB-style file with coordinates for d1xw6a1.
(The format of our PDB-style files is described here.)

Timeline for d1xw6a1: