SCOPe 2.08: Domain d1xw6c2: 1xw6 C:1-84

Lineage for d1xw6c2 (1xw6 C:1-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52867] (17 PDB entries)
   Uniprot P09488 ! Uniprot P28161

8. Domain d1xw6c2: 1xw6 C:1-84 [116108]
   Other proteins in same PDB: d1xw6a1, d1xw6b1, d1xw6c1, d1xw6d1
   complexed with gsh

Details for d1xw6c2

PDB Entry: 1xw6, 1.9 Å

PDB Description: 1.9 angstrom resolution structure of human glutathione s-transferase m1a-1a complexed with glutathione

PDB Compounds: (C:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d1xw6c2:

Sequence; same for both SEQRES and ATOM records:

>d1xw6c2 c.47.1.5 (C:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgahkitqsnailcyiarkhn

Timeline for d1xw6c2:

• d1xw6c2 first appeared in SCOP 1.71
  
• d1xw6c2 appears in SCOPe 2.07