SCOP 1.71: Domain d1xw6a1: 1xw6 A:85-217

Lineage for d1xw6a1 (1xw6 A:85-217)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (10 PDB entries)

8. Domain d1xw6a1: 1xw6 A:85-217 [116103]
   Other proteins in same PDB: d1xw6a2, d1xw6b2, d1xw6c2, d1xw6d2

Details for d1xw6a1

PDB Entry: 1xw6, 1.9 Å

PDB Description: 1.9 angstrom resolution structure of human glutathione s-transferase m1a-1a complexed with glutathione

SCOP Domain Sequences for d1xw6a1:

Sequence; same for both SEQRES and ATOM records:

>d1xw6a1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens)}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

Timeline for d1xw6a1:

• d1xw6a1 is new in SCOP 1.71
  
• d1xw6a1 appears in SCOP 1.73
  
• d1xw6a1 appears in the current release, SCOPe 2.08