PDB entry 1xw6

View 1xw6 on RCSB PDB site
Description: 1.9 angstrom resolution structure of human glutathione S-transferase M1A-1A complexed with glutathione
Class: transferase
Keywords: transferase, glutathione, conjugation, detoxification, cytosolic, dimer, active site
Deposited on 2004-10-29, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xw6a1, d1xw6a2
  • Chain 'B':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xw6b1, d1xw6b2
  • Chain 'C':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xw6c1, d1xw6c2
  • Chain 'D':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xw6d1, d1xw6d2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xw6A (A:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xw6A (A:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xw6B (B:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xw6B (B:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xw6C (C:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xw6C (C:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xw6D (D:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xw6D (D:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk