SCOPe 2.08: Domain d1xw6c1: 1xw6 C:85-217

Lineage for d1xw6c1 (1xw6 C:85-217)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (17 PDB entries)
   Uniprot P09488 P28161

8. Domain d1xw6c1: 1xw6 C:85-217 [116107]
   Other proteins in same PDB: d1xw6a2, d1xw6b2, d1xw6c2, d1xw6d2
   complexed with gsh

Details for d1xw6c1

PDB Entry: 1xw6, 1.9 Å

PDB Description: 1.9 angstrom resolution structure of human glutathione s-transferase m1a-1a complexed with glutathione

PDB Compounds: (C:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d1xw6c1:

Sequence; same for both SEQRES and ATOM records:

>d1xw6c1 a.45.1.1 (C:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

Timeline for d1xw6c1:

• d1xw6c1 first appeared in SCOP 1.71
  
• d1xw6c1 appears in SCOPe 2.07