Class a: All alpha proteins [46456] (290 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Flt3 ligand [47297] (1 species) forms dimer similar to the M-CSF and SCF dimers |
Species Human (Homo sapiens) [TaxId:9606] [47298] (1 PDB entry) |
Domain d1etea_: 1ete A: [16869] complexed with zn |
PDB Entry: 1ete (more details), 2.2 Å
SCOPe Domain Sequences for d1etea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1etea_ a.26.1.2 (A:) Flt3 ligand {Human (Homo sapiens) [TaxId: 9606]} tqdcsfqhspissdfavkirelsdyllqdypvtvasnlqddelcgglwrlvlaqrwmerl ktvagskmqgllervnteihfvtkcafqpppsclrfvqtnisrllqetseqlvalkpwit rqnfsrclelqcqp
Timeline for d1etea_: