Lineage for d1etea_ (1ete A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2641Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 2642Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 2696Family a.26.1.2: Short-chain cytokines [47286] (9 proteins)
  6. Protein Flt3 ligand [47297] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47298] (1 PDB entry)
  8. Domain d1etea_: 1ete A: [16869]

Details for d1etea_

PDB Entry: 1ete (more details), 2.2 Å

PDB Description: crystal structure of the flt3 ligand

SCOP Domain Sequences for d1etea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etea_ a.26.1.2 (A:) Flt3 ligand {Human (Homo sapiens)}
tqdcsfqhspissdfavkirelsdyllqdypvtvasnlqddelcgglwrlvlaqrwmerl
ktvagskmqgllervnteihfvtkcafqpppsclrfvqtnisrllqetseqlvalkpwit
rqnfsrclelqcqp

SCOP Domain Coordinates for d1etea_ are not available.

Timeline for d1etea_:

Domains from other chains:
(mouse over for more information)
d1eteb_, d1etec_, d1eted_