Lineage for d1eteb_ (1ete B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705554Protein Flt3 ligand [47297] (1 species)
    forms dimer similar to the M-CSF and SCF dimers
  7. 2705555Species Human (Homo sapiens) [TaxId:9606] [47298] (1 PDB entry)
  8. 2705557Domain d1eteb_: 1ete B: [16870]
    complexed with zn

Details for d1eteb_

PDB Entry: 1ete (more details), 2.2 Å

PDB Description: crystal structure of the flt3 ligand
PDB Compounds: (B:) flt3 ligand

SCOPe Domain Sequences for d1eteb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eteb_ a.26.1.2 (B:) Flt3 ligand {Human (Homo sapiens) [TaxId: 9606]}
tqdcsfqhspissdfavkirelsdyllqdypvtvasnlqddelcgglwrlvlaqrwmerl
ktvagskmqgllervnteihfvtkcafqpppsclrfvqtnisrllqetseqlvalkpwit
rqnfsrclelqcqp

SCOPe Domain Coordinates for d1eteb_:

Click to download the PDB-style file with coordinates for d1eteb_.
(The format of our PDB-style files is described here.)

Timeline for d1eteb_: