PDB entry 1ete

View 1ete on RCSB PDB site
Description: crystal structure of the flt3 ligand
Class: cytokine
Keywords: four-helix bundle, CYTOKINE
Deposited on 2000-04-12, released 2000-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.239
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flt3 ligand
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49771 (0-133)
      • conflict (40)
    Domains in SCOPe 2.07: d1etea_
  • Chain 'B':
    Compound: flt3 ligand
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49771 (0-133)
      • conflict (40)
    Domains in SCOPe 2.07: d1eteb_
  • Chain 'C':
    Compound: flt3 ligand
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49771
      • conflict (40)
    Domains in SCOPe 2.07: d1etec_
  • Chain 'D':
    Compound: flt3 ligand
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49771
      • conflict (40)
    Domains in SCOPe 2.07: d1eted_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eteA (A:)
    tqdcsfqhspissdfavkirelsdyllqdypvtvasnlqddelcgglwrlvlaqrwmerl
    ktvagskmqgllervnteihfvtkcafqpppsclrfvqtnisrllqetseqlvalkpwit
    rqnfsrclelqcqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eteB (B:)
    tqdcsfqhspissdfavkirelsdyllqdypvtvasnlqddelcgglwrlvlaqrwmerl
    ktvagskmqgllervnteihfvtkcafqpppsclrfvqtnisrllqetseqlvalkpwit
    rqnfsrclelqcqp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eteC (C:)
    tqdcsfqhspissdfavkirelsdyllqdypvtvasnlqddelcgglwrlvlaqrwmerl
    ktvagskmqgllervnteihfvtkcafqpppsclrfvqtnisrllqetseqlvalkpwit
    rqnfsrclelqcqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eteC (C:)
    qdcsfqhspissdfavkirelsdyllqdypvtvasnlqddelcgglwrlvlaqrwmerlk
    tvagskmqgllervnteihfvtkcafqpppsclrfvqtnisrllqetseqlvalkpwitr
    qnfsrclelqc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eteD (D:)
    tqdcsfqhspissdfavkirelsdyllqdypvtvasnlqddelcgglwrlvlaqrwmerl
    ktvagskmqgllervnteihfvtkcafqpppsclrfvqtnisrllqetseqlvalkpwit
    rqnfsrclelqcqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eteD (D:)
    dcsfqhspissdfavkirelsdyllqdypvtvasnlqddelcgglwrlvlaqrwmerlkt
    vagskmqgllervnteihfvtkcafqpppsclrfvqtnisrllqetseqlvalkpwitrq
    nfsrclelqc