![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) ![]() |
![]() | Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins) |
![]() | Protein Protooncoprotein Her2 extracellular domain [82889] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82890] (2 PDB entries) |
![]() | Domain d1s78b3: 1s78 B:166-322 [98622] Other proteins in same PDB: d1s78a1, d1s78a2, d1s78b1, d1s78b2, d1s78c1, d1s78c2, d1s78d1, d1s78d2, d1s78e1, d1s78e2, d1s78f1, d1s78f2 complexed with nag |
PDB Entry: 1s78 (more details), 3.25 Å
SCOPe Domain Sequences for d1s78b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s78b3 g.3.9.1 (B:166-322) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd vgsctlvcplhnqevtaedgtqrcekcskpcarvcyg
Timeline for d1s78b3: