Lineage for d1s78a1 (1s78 A:1-165)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353403Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1353461Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1353531Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 1353561Protein Protooncoprotein Her2 extracellular domain [82328] (2 species)
  7. 1353562Species Human (Homo sapiens) [TaxId:9606] [82329] (2 PDB entries)
  8. 1353565Domain d1s78a1: 1s78 A:1-165 [98616]
    Other proteins in same PDB: d1s78a3, d1s78a4, d1s78b3, d1s78b4, d1s78c1, d1s78c2, d1s78d1, d1s78d2, d1s78e1, d1s78e2, d1s78f1, d1s78f2
    complexed with nag

Details for d1s78a1

PDB Entry: 1s78 (more details), 3.25 Å

PDB Description: insights into erbb signaling from the structure of the erbb2- pertuzumab complex
PDB Compounds: (A:) Receptor protein-tyrosine kinase erbB-2

SCOPe Domain Sequences for d1s78a1:

Sequence, based on SEQRES records: (download)

>d1s78a1 c.10.2.5 (A:1-165) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg
yvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelql
rslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtn

Sequence, based on observed residues (ATOM records): (download)

>d1s78a1 c.10.2.5 (A:1-165) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg
yvliahnqvrqvplqrlrivrgtqlfednyalavldngdplspgglrelqlrslteilkg
gvliqrnpqlcyqdtilwkdifhknnqlaltlidtn

SCOPe Domain Coordinates for d1s78a1:

Click to download the PDB-style file with coordinates for d1s78a1.
(The format of our PDB-style files is described here.)

Timeline for d1s78a1: