SCOPe 2.03: Domain d1s78d2: 1s78 D:114-216

Lineage for d1s78d2 (1s78 D:114-216)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (177 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1s78d2: 1s78 D:114-216 [98627]
   Other proteins in same PDB: d1s78a1, d1s78a2, d1s78a3, d1s78a4, d1s78b1, d1s78b2, d1s78b3, d1s78b4, d1s78c1, d1s78c2, d1s78d1, d1s78e1, d1s78e2, d1s78f1
   part of anti-ERBb2 Fab Pertuzumab
   complexed with nag

Details for d1s78d2

PDB Entry: 1s78, 3.25 Å

PDB Description: insights into erbb signaling from the structure of the erbb2- pertuzumab complex

PDB Compounds: (D:) Pertuzumab Fab heavy chain

SCOPe Domain Sequences for d1s78d2:

Sequence; same for both SEQRES and ATOM records:

>d1s78d2 b.1.1.2 (D:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1s78d2:

• d1s78d2 first appeared in SCOP 1.67
  
• d1s78d2 appears in SCOPe 2.02
  
• d1s78d2 appears in SCOPe 2.04
  
• d1s78d2 appears in the current release, SCOPe 2.08