![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species) follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases |
![]() | Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries) |
![]() | Domain d1pj9a1: 1pj9 A:496-581 [94754] Other proteins in same PDB: d1pj9a2, d1pj9a3, d1pj9a4 complexed with acy, ca, glc, mpd; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1pj9 (more details), 2 Å
SCOPe Domain Sequences for d1pj9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pj9a1 b.1.18.2 (A:496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]} tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa vaggnynikvanaagtasnvydnfev
Timeline for d1pj9a1: