Lineage for d1pj9a2 (1pj9 A:582-686)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768599Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2768632Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 2768633Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)
  8. 2768640Domain d1pj9a2: 1pj9 A:582-686 [94755]
    Other proteins in same PDB: d1pj9a1, d1pj9a3, d1pj9a4
    complexed with acy, ca, glc, mpd; mutant

Details for d1pj9a2

PDB Entry: 1pj9 (more details), 2 Å

PDB Description: bacillus circulans strain 251 loop mutant 183-195
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1pj9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj9a2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOPe Domain Coordinates for d1pj9a2:

Click to download the PDB-style file with coordinates for d1pj9a2.
(The format of our PDB-style files is described here.)

Timeline for d1pj9a2: