Lineage for d1oayo_ (1oay O:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741756Species Norway rat (Rattus norvegicus) [TaxId:10116] [101504] (7 PDB entries)
  8. 2741770Domain d1oayo_: 1oay O: [92740]
    Other proteins in same PDB: d1oayh_, d1oayj_
    part of IgE Fv spe-7
    complexed with fur

Details for d1oayo_

PDB Entry: 1oay (more details), 2.66 Å

PDB Description: Antibody multispecificity mediated by conformational diversity
PDB Compounds: (O:) immunoglobulin e

SCOPe Domain Sequences for d1oayo_:

Sequence, based on SEQRES records: (download)

>d1oayo_ b.1.1.1 (O:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl

Sequence, based on observed residues (ATOM records): (download)

>d1oayo_ b.1.1.1 (O:) Immunoglobulin light chain lambda variable domain, VL-lambda {Norway rat (Rattus norvegicus) [TaxId: 10116]}
avvtqesalttspgetvtltcrsstavtnwvqekprhlftgliggtnnraparfsgslig
nkaaltitgaqtedeaiyfcavfgggtkltvl

SCOPe Domain Coordinates for d1oayo_:

Click to download the PDB-style file with coordinates for d1oayo_.
(The format of our PDB-style files is described here.)

Timeline for d1oayo_: