Lineage for d1oayh_ (1oay H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740657Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)
  8. 2740680Domain d1oayh_: 1oay H: [92733]
    Other proteins in same PDB: d1oayl_, d1oaym_, d1oayn_, d1oayo_
    part of IgE Fv spe-7
    complexed with fur

Details for d1oayh_

PDB Entry: 1oay (more details), 2.66 Å

PDB Description: Antibody multispecificity mediated by conformational diversity
PDB Compounds: (H:) immunoglobulin e

SCOPe Domain Sequences for d1oayh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oayh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkyn
lkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvssa
a

SCOPe Domain Coordinates for d1oayh_:

Click to download the PDB-style file with coordinates for d1oayh_.
(The format of our PDB-style files is described here.)

Timeline for d1oayh_: