SCOPe 2.05: Domain d1nzib2: 1nzi B:118-159

Lineage for d1nzib2 (1nzi B:118-159)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Complement C1S component [90143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90144] (3 PDB entries)

8. Domain d1nzib2: 1nzi B:118-159 [86452]
   Other proteins in same PDB: d1nzia1, d1nzib1
   complexed with ca, mg

Details for d1nzib2

PDB Entry: 1nzi, 1.5 Å

PDB Description: Crystal Structure of the CUB1-EGF Interaction Domain of Complement Protease C1s

PDB Compounds: (B:) Complement C1s component

SCOPe Domain Sequences for d1nzib2:

Sequence; same for both SEQRES and ATOM records:

>d1nzib2 g.3.11.1 (B:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}
nectdfvdvpcshfcnnfiggyfcscppeyflhddmkncgvn

Timeline for d1nzib2:

• d1nzib2 first appeared in SCOP 1.65
  
• d1nzib2 appears in SCOPe 2.04
  
• d1nzib2 appears in SCOPe 2.06
  
• d1nzib2 appears in the current release, SCOPe 2.08