Lineage for d1nzib2 (1nzi B:118-159)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258234Protein Complement C1S component [90143] (1 species)
  7. 2258235Species Human (Homo sapiens) [TaxId:9606] [90144] (3 PDB entries)
  8. 2258237Domain d1nzib2: 1nzi B:118-159 [86452]
    Other proteins in same PDB: d1nzia1, d1nzib1
    complexed with ca, mg

Details for d1nzib2

PDB Entry: 1nzi (more details), 1.5 Å

PDB Description: Crystal Structure of the CUB1-EGF Interaction Domain of Complement Protease C1s
PDB Compounds: (B:) Complement C1s component

SCOPe Domain Sequences for d1nzib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzib2 g.3.11.1 (B:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}
nectdfvdvpcshfcnnfiggyfcscppeyflhddmkncgvn

SCOPe Domain Coordinates for d1nzib2:

Click to download the PDB-style file with coordinates for d1nzib2.
(The format of our PDB-style files is described here.)

Timeline for d1nzib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nzib1