Class g: Small proteins [56992] (66 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies) disulphide-bound fold; contains beta-hairpin with two adjacent disulphides |
Superfamily g.3.11: EGF/Laminin [57196] (6 families) |
Family g.3.11.1: EGF-type module [57197] (20 proteins) |
Protein Complement C1S component [90143] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90144] (1 PDB entry) |
Domain d1nzib2: 1nzi B:118-159 [86452] Other proteins in same PDB: d1nzia1, d1nzib1 complexed with ca, mg |
PDB Entry: 1nzi (more details), 1.5 Å
SCOP Domain Sequences for d1nzib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nzib2 g.3.11.1 (B:118-159) Complement C1S component {Human (Homo sapiens)} nectdfvdvpcshfcnnfiggyfcscppeyflhddmkncgvn
Timeline for d1nzib2: