Lineage for d1nzib2 (1nzi B:118-159)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 342099Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 342100Family g.3.11.1: EGF-type module [57197] (20 proteins)
  6. 342130Protein Complement C1S component [90143] (1 species)
  7. 342131Species Human (Homo sapiens) [TaxId:9606] [90144] (1 PDB entry)
  8. 342133Domain d1nzib2: 1nzi B:118-159 [86452]
    Other proteins in same PDB: d1nzia1, d1nzib1
    complexed with ca, mg

Details for d1nzib2

PDB Entry: 1nzi (more details), 1.5 Å

PDB Description: Crystal Structure of the CUB1-EGF Interaction Domain of Complement Protease C1s

SCOP Domain Sequences for d1nzib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzib2 g.3.11.1 (B:118-159) Complement C1S component {Human (Homo sapiens)}
nectdfvdvpcshfcnnfiggyfcscppeyflhddmkncgvn

SCOP Domain Coordinates for d1nzib2:

Click to download the PDB-style file with coordinates for d1nzib2.
(The format of our PDB-style files is described here.)

Timeline for d1nzib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nzib1