SCOPe 2.08: Domain d1miua5: 1miu A:2971-3103

Lineage for d1miua5 (1miu A:2971-3103)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
   barrel, closed; n=5, S=10

6. Protein OB-fold domains of BRCA2, C-terminal domain [418919] (2 species)
   protein duplication: tandem repeat of three OB-fold domains
7. Species Mouse (Mus musculus) [TaxId:10090] [419345] (2 PDB entries)

8. Domain d1miua5: 1miu A:2971-3103 [79157]
   Other proteins in same PDB: d1miua1, d1miua2, d1miua3, d1miua4, d1miub_
   protein/DNA complex; complexed with hg
   has additional insertions and/or extensions that are not grouped together

Details for d1miua5

PDB Entry: 1miu, 3.1 Å

PDB Description: Structure of a BRCA2-DSS1 complex

PDB Compounds: (A:) Breast Cancer type 2 susceptibility protein

SCOPe Domain Sequences for d1miua5:

Sequence; same for both SEQRES and ATOM records:

>d1miua5 b.40.4.3 (A:2971-3103) OB-fold domains of BRCA2, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
reslhfsrlsdpafqppcsevdvvgvvvsvvkpiglaplvylsdeclnllvvkfgidlne
dikprvliaasnlqcqpestsgvptlfaghfsifsaspkeayfqekvnnlkhaienidtf
ykeaekklihvle

Timeline for d1miua5:

• d1miua5 first appeared in SCOP 1.63
  
• d1miua5 appears in SCOPe 2.07