Lineage for d1miua3 (1miu A:2590-2722)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789377Protein OB-fold domains of BRCA2, N- and middle domain [418918] (2 species)
    protein duplication: tandem repeat of three OB-fold domains
  7. 2789378Species Mouse (Mus musculus) [TaxId:10090] [419344] (2 PDB entries)
  8. 2789379Domain d1miua3: 1miu A:2590-2722 [79155]
    Other proteins in same PDB: d1miua1, d1miua2, d1miua5, d1miub_
    protein/DNA complex; complexed with hg

Details for d1miua3

PDB Entry: 1miu (more details), 3.1 Å

PDB Description: Structure of a BRCA2-DSS1 complex
PDB Compounds: (A:) Breast Cancer type 2 susceptibility protein

SCOPe Domain Sequences for d1miua3:

Sequence, based on SEQRES records: (download)

>d1miua3 b.40.4.3 (A:2590-2722) OB-fold domains of BRCA2, N- and middle domain {Mouse (Mus musculus) [TaxId: 10090]}
rsalkkilerddtaaktlvlcisdiispstkvsetsggktsgedankvdtieltdgwyav
raqldpplmalvksgkltvgqkiitqgaelvgspdacapleapdslrlkisanstrparw
hsrlgffrdprpf

Sequence, based on observed residues (ATOM records): (download)

>d1miua3 b.40.4.3 (A:2590-2722) OB-fold domains of BRCA2, N- and middle domain {Mouse (Mus musculus) [TaxId: 10090]}
rsalkkilerddtaaktlvlcisdivdtieltdgwyavraqldpplmalvksgkltvgqk
iitqgaelvgspdacapleapdslrlkisanstrparwhsrlgffrdprpf

SCOPe Domain Coordinates for d1miua3:

Click to download the PDB-style file with coordinates for d1miua3.
(The format of our PDB-style files is described here.)

Timeline for d1miua3: