Lineage for d1lnqc2 (1lnq C:19-98)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 267828Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 267829Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 267830Family f.14.1.1: Voltage-gated potassium channels [81323] (2 proteins)
  6. 267859Protein Potassium channel-related protein MthK [75643] (1 species)
    calcium gated potassium channel
  7. 267860Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [75644] (1 PDB entry)
  8. 267863Domain d1lnqc2: 1lnq C:19-98 [74054]
    Other proteins in same PDB: d1lnqa1, d1lnqb1, d1lnqc1, d1lnqd1, d1lnqe1, d1lnqf1, d1lnqg1, d1lnqh1

Details for d1lnqc2

PDB Entry: 1lnq (more details), 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a

SCOP Domain Sequences for d1lnqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnqc2 f.14.1.1 (C:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus}
patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
livlgigtfavaverllefl

SCOP Domain Coordinates for d1lnqc2:

Click to download the PDB-style file with coordinates for d1lnqc2.
(The format of our PDB-style files is described here.)

Timeline for d1lnqc2: