SCOP 1.63: Domain d1lnqb2: 1lnq B:19-98

Lineage for d1lnqb2 (1lnq B:19-98)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (2 proteins)

6. Protein Potassium channel-related protein MthK [75643] (1 species)
   calcium gated potassium channel

7. Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [75644] (1 PDB entry)

8. Domain d1lnqb2: 1lnq B:19-98 [74052]
   Other proteins in same PDB: d1lnqa1, d1lnqb1, d1lnqc1, d1lnqd1, d1lnqe1, d1lnqf1, d1lnqg1, d1lnqh1

Details for d1lnqb2

PDB Entry: 1lnq, 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a

SCOP Domain Sequences for d1lnqb2:

Sequence; same for both SEQRES and ATOM records:

>d1lnqb2 f.14.1.1 (B:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus}
patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
livlgigtfavaverllefl

Timeline for d1lnqb2:

• d1lnqb2 first appeared in SCOP 1.61
  
• d1lnqb2 appears in SCOP 1.65
  
• d1lnqb2 appears in the current release, SCOPe 2.08