Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins) |
Protein Potassium channel-related protein MthK [75122] (1 species) includes extra C-terminal alpha+beta subdomain, residues 261-336 |
Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [75123] (1 PDB entry) |
Domain d1lnqc1: 1lnq C:116-336 [74053] Other proteins in same PDB: d1lnqa2, d1lnqb2, d1lnqc2, d1lnqd2, d1lnqe2, d1lnqf2, d1lnqg2, d1lnqh2 |
PDB Entry: 1lnq (more details), 3.3 Å
SCOP Domain Sequences for d1lnqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnqc1 c.2.1.9 (C:116-336) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus} rhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanv rgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvis grlmsrsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiig vgrgdeliidpprdysfragdiilgigkpeeierlknyisa
Timeline for d1lnqc1: