Lineage for d1h6ya_ (1h6y A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1116326Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1116327Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1116601Family b.18.1.7: CBM22 [49811] (1 protein)
    CBM family 22, formerly x6b domain
  6. 1116602Protein Xylan-binding domain [49812] (1 species)
  7. 1116603Species Clostridium thermocellum [TaxId:1515] [49813] (3 PDB entries)
  8. 1116604Domain d1h6ya_: 1h6y A: [70904]
    complexed with ca

Details for d1h6ya_

PDB Entry: 1h6y (more details), 2.12 Å

PDB Description: the role of conserved amino acids in the cleft of the c-terminal family 22 carbohydrate binding module of clostridium thermocellum xyn10b in ligand binding
PDB Compounds: (A:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d1h6ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6ya_ b.18.1.7 (A:) Xylan-binding domain {Clostridium thermocellum [TaxId: 1515]}
pdangyyyhdtfegsvgqwtargpaevllsgrtaykgsesllvrnrtaawngaqralnpr
tfvpgntycfsvvasfiegassttfcmklqyvdgsgtqrydtidmktvgpnqwvhlynpq
yripsdatdmyvyvataddtinfyideaigavagtvi

SCOPe Domain Coordinates for d1h6ya_:

Click to download the PDB-style file with coordinates for d1h6ya_.
(The format of our PDB-style files is described here.)

Timeline for d1h6ya_: