Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.7: CBM22 [49811] (1 protein) CBM family 22, formerly x6b domain |
Protein Xylan-binding domain [49812] (1 species) |
Species Clostridium thermocellum [TaxId:1515] [49813] (3 PDB entries) |
Domain d1h6yb_: 1h6y B: [70905] complexed with ca |
PDB Entry: 1h6y (more details), 2.12 Å
SCOPe Domain Sequences for d1h6yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6yb_ b.18.1.7 (B:) Xylan-binding domain {Clostridium thermocellum [TaxId: 1515]} pdangyyyhdtfegsvgqwtargpaevllsgrtaykgsesllvrnrtaawngaqralnpr tfvpgntycfsvvasfiegassttfcmklqyvdgsgtqrydtidmktvgpnqwvhlynpq yripsdatdmyvyvataddtinfyideaigavagtvi
Timeline for d1h6yb_: