SCOPe 2.03: Domain d1h6ya_: 1h6y A:

Lineage for d1h6ya_ (1h6y A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.7: CBM22 [49811] (1 protein)
   CBM family 22, formerly x6b domain
   automatically mapped to Pfam PF02018

6. Protein Xylan-binding domain [49812] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [49813] (3 PDB entries)

8. Domain d1h6ya_: 1h6y A: [70904]
   complexed with ca

Details for d1h6ya_

PDB Entry: 1h6y, 2.12 Å

PDB Description: the role of conserved amino acids in the cleft of the c-terminal family 22 carbohydrate binding module of clostridium thermocellum xyn10b in ligand binding

PDB Compounds: (A:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d1h6ya_:

Sequence; same for both SEQRES and ATOM records:

>d1h6ya_ b.18.1.7 (A:) Xylan-binding domain {Clostridium thermocellum [TaxId: 1515]}
pdangyyyhdtfegsvgqwtargpaevllsgrtaykgsesllvrnrtaawngaqralnpr
tfvpgntycfsvvasfiegassttfcmklqyvdgsgtqrydtidmktvgpnqwvhlynpq
yripsdatdmyvyvataddtinfyideaigavagtvi

Timeline for d1h6ya_:

• d1h6ya_ first appeared in SCOP 1.61
  
• d1h6ya_ appears in SCOPe 2.02
  
• d1h6ya_ appears in SCOPe 2.04
  
• d1h6ya_ appears in the current release, SCOPe 2.08