SCOP 1.61: Domain d1h6ya_: 1h6y A:

Lineage for d1h6ya_ (1h6y A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (15 families)

5. Family b.18.1.7: CBM22 [49811] (1 protein)

6. Protein Xylan-binding domain [49812] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [49813] (3 PDB entries)

8. Domain d1h6ya_: 1h6y A: [70904]

Details for d1h6ya_

PDB Entry: 1h6y, 2.12 Å

PDB Description: the role of conserved amino acids in the cleft of the c-terminal family 22 carbohydrate binding module of clostridium thermocellum xyn10b in ligand binding

SCOP Domain Sequences for d1h6ya_:

Sequence; same for both SEQRES and ATOM records:

>d1h6ya_ b.18.1.7 (A:) Xylan-binding domain {Clostridium thermocellum}
pdangyyyhdtfegsvgqwtargpaevllsgrtaykgsesllvrnrtaawngaqralnpr
tfvpgntycfsvvasfiegassttfcmklqyvdgsgtqrydtidmktvgpnqwvhlynpq
yripsdatdmyvyvataddtinfyideaigavagtvi

Timeline for d1h6ya_:

• d1h6ya_ is new in SCOP 1.61
  
• d1h6ya_ appears in SCOP 1.63
  
• d1h6ya_ appears in the current release, SCOPe 2.08