Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Non-hem ferritin [63524] (7 species) |
Species Campylobacter jejuni [TaxId:197] [69005] (1 PDB entry) |
Domain d1krqa_: 1krq A: [68855] |
PDB Entry: 1krq (more details), 2.7 Å
SCOPe Domain Sequences for d1krqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1krqa_ a.25.1.1 (A:) Non-hem ferritin {Campylobacter jejuni [TaxId: 197]} mlskevvkllneqinkemyaanlylsmsswcyensldgagaflfahaseesdhakklity lnetdshvelqevkqpeqnfkslldvfektyeheqfitksintlvehmlthkdystfnfl qwyvseqheeealfrgivdkikligehgnglyladqyiknialsr
Timeline for d1krqa_: