Lineage for d1krqa_ (1krq A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96482Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 96483Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 96484Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 96592Protein Non-hem ferritin [63524] (2 species)
  7. 96593Species Campylobacter jejuni [TaxId:197] [69005] (1 PDB entry)
  8. 96594Domain d1krqa_: 1krq A: [68855]

Details for d1krqa_

PDB Entry: 1krq (more details), 2.7 Å

PDB Description: crystal structure analysis of campylobacter jejuni ferritin

SCOP Domain Sequences for d1krqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krqa_ a.25.1.1 (A:) Non-hem ferritin {Campylobacter jejuni}
mlskevvkllneqinkemyaanlylsmsswcyensldgagaflfahaseesdhakklity
lnetdshvelqevkqpeqnfkslldvfektyeheqfitksintlvehmlthkdystfnfl
qwyvseqheeealfrgivdkikligehgnglyladqyiknialsr

SCOP Domain Coordinates for d1krqa_:

Click to download the PDB-style file with coordinates for d1krqa_.
(The format of our PDB-style files is described here.)

Timeline for d1krqa_: