![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (8 proteins) |
![]() | Protein L-Ala-D/L-Glu epimerase [69711] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [69713] (1 PDB entry) |
![]() | Domain d1jpmc2: 1jpm C:1-125 [67036] Other proteins in same PDB: d1jpma1, d1jpmb1, d1jpmc1, d1jpmd1 |
PDB Entry: 1jpm (more details), 2.25 Å
SCOP Domain Sequences for d1jpmc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpmc2 d.54.1.1 (C:1-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis} mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply qmlgg
Timeline for d1jpmc2: