| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
| Protein L-Ala-D/L-Glu epimerase [69711] (2 species) |
| Species Bacillus subtilis [TaxId:1423] [69713] (2 PDB entries) Uniprot O34508 |
| Domain d1jpmc2: 1jpm C:1-125 [67036] Other proteins in same PDB: d1jpma1, d1jpmb1, d1jpmc1, d1jpmd1 complexed with gol, mg |
PDB Entry: 1jpm (more details), 2.25 Å
SCOPe Domain Sequences for d1jpmc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpmc2 d.54.1.1 (C:1-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]}
mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
qmlgg
Timeline for d1jpmc2: