SCOP 1.59: Domain d1jpmc1: 1jpm C:126-358

Lineage for d1jpmc1 (1jpm C:126-358)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (7 proteins)

6. Protein L-Ala-D/L-Glu epimerase [69397] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [69399] (1 PDB entry)

8. Domain d1jpmc1: 1jpm C:126-358 [67035]
   Other proteins in same PDB: d1jpma2, d1jpmb2, d1jpmc2, d1jpmd2

Details for d1jpmc1

PDB Entry: 1jpm, 2.25 Å

PDB Description: L-Ala-D/L-Glu Epimerase

SCOP Domain Sequences for d1jpmc1:

Sequence; same for both SEQRES and ATOM records:

>d1jpmc1 c.1.11.2 (C:126-358) L-Ala-D/L-Glu epimerase {Bacillus subtilis}
yrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirkrvgsa
vklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtpimade
svftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmietklgit
aaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaa

Timeline for d1jpmc1:

• d1jpmc1 is new in SCOP 1.59
  
• d1jpmc1 appears in SCOP 1.61
  
• d1jpmc1 appears in the current release, SCOPe 2.08