Lineage for d1jpmc1 (1jpm C:126-358)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174266Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 174297Family c.1.11.2: D-glucarate dehydratase-like [51609] (7 proteins)
  6. 174340Protein L-Ala-D/L-Glu epimerase [69397] (2 species)
  7. 174341Species Bacillus subtilis [TaxId:1423] [69399] (1 PDB entry)
  8. 174344Domain d1jpmc1: 1jpm C:126-358 [67035]
    Other proteins in same PDB: d1jpma2, d1jpmb2, d1jpmc2, d1jpmd2

Details for d1jpmc1

PDB Entry: 1jpm (more details), 2.25 Å

PDB Description: L-Ala-D/L-Glu Epimerase

SCOP Domain Sequences for d1jpmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpmc1 c.1.11.2 (C:126-358) L-Ala-D/L-Glu epimerase {Bacillus subtilis}
yrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirkrvgsa
vklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtpimade
svftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmietklgit
aaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaa

SCOP Domain Coordinates for d1jpmc1:

Click to download the PDB-style file with coordinates for d1jpmc1.
(The format of our PDB-style files is described here.)

Timeline for d1jpmc1: