SCOP 1.59: Domain d1g1sb1: 1g1s B:1-118

Lineage for d1g1sb1 (1g1s B:1-118)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)

4. Superfamily d.169.1: C-type lectin-like [56436] (5 families)

5. Family d.169.1.1: C-type lectin domain [56437] (17 proteins)

6. Protein E-selectin [56456] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56457] (5 PDB entries)

8. Domain d1g1sb1: 1g1s B:1-118 [65102]
   Other proteins in same PDB: d1g1sa2, d1g1sb2

Details for d1g1sb1

PDB Entry: 1g1s, 1.9 Å

PDB Description: p-selectin lectin/egf domains complexed with psgl-1 peptide

SCOP Domain Sequences for d1g1sb1:

Sequence; same for both SEQRES and ATOM records:

>d1g1sb1 d.169.1.1 (B:1-118) E-selectin {Human (Homo sapiens)}
wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcy

Timeline for d1g1sb1:

• d1g1sb1 is new in SCOP 1.59
  
• d1g1sb1 appears in SCOP 1.61
  
• d1g1sb1 appears in the current release, SCOPe 2.08