Lineage for d1g1sa2 (1g1s A:119-158)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 143091Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 143092Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 143119Protein E-selectin, EGF-domain [57203] (1 species)
  7. 143120Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries)
  8. 143122Domain d1g1sa2: 1g1s A:119-158 [65101]
    Other proteins in same PDB: d1g1sa1, d1g1sb1

Details for d1g1sa2

PDB Entry: 1g1s (more details), 1.9 Å

PDB Description: p-selectin lectin/egf domains complexed with psgl-1 peptide

SCOP Domain Sequences for d1g1sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens)}
tascqdmscskqgecletignytcscypgfygpeceyvrd

SCOP Domain Coordinates for d1g1sa2:

Click to download the PDB-style file with coordinates for d1g1sa2.
(The format of our PDB-style files is described here.)

Timeline for d1g1sa2:

143122
d1g1sa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1g1sa1