PDB entry 1g1s

View 1g1s on RCSB PDB site
Description: p-selectin lectin/egf domains complexed with psgl-1 peptide
Deposited on 2000-10-13, released 2001-10-13
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-13, with a file datestamp of 2001-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1sA (A:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvrd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1sB (B:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvr