![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) ![]() |
![]() | Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (1 protein) |
![]() | Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species) interacts with subunit I and III, function unknown, non-essential for the enzymatic activity |
![]() | Species Paracoccus denitrificans [TaxId:266] [81465] (1 PDB entry) |
![]() | Domain d1qled_: 1qle D: [43623] Other proteins in same PDB: d1qlea_, d1qleb1, d1qleb2, d1qlec_, d1qleh_, d1qlel_ |
PDB Entry: 1qle (more details), 3 Å
SCOP Domain Sequences for d1qled_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qled_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Paracoccus denitrificans} tdhkhgemdirhqqatfagfikgatwvsilsiavlvflalans
Timeline for d1qled_: