SCOP 1.69: Domain d1qled_: 1qle D:

Lineage for d1qled_ (1qle D:)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family)

5. Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (1 protein)

6. Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species)
   interacts with subunit I and III, function unknown, non-essential for the enzymatic activity

7. Species Paracoccus denitrificans [TaxId:266] [81465] (1 PDB entry)

8. Domain d1qled_: 1qle D: [43623]
   Other proteins in same PDB: d1qlea_, d1qleb1, d1qleb2, d1qlec_, d1qleh_, d1qlel_

Details for d1qled_

PDB Entry: 1qle, 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

SCOP Domain Sequences for d1qled_:

Sequence; same for both SEQRES and ATOM records:

>d1qled_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Paracoccus denitrificans}
tdhkhgemdirhqqatfagfikgatwvsilsiavlvflalans

Timeline for d1qled_:

• d1qled_ first appeared (with stable ids) in SCOP 1.55, called d1qled1
  
• d1qled_ appears in SCOP 1.67
  
• d1qled_ appears in SCOP 1.71
  
• d1qled_ appears in the current release, SCOPe 2.08