![]() | Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
![]() | Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
![]() | Superfamily f.2.1: Membrane all-alpha [56869] (10 families) ![]() |
![]() | Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins) |
![]() | Protein Cytochrome c oxidase [56884] (3 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [56886] (2 PDB entries) |
![]() | Domain d1qled1: 1qle D: [43623] Other proteins in same PDB: d1qleb1, d1qleh_, d1qlel_ |
PDB Entry: 1qle (more details), 3 Å
SCOP Domain Sequences for d1qled1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qled1 f.2.1.3 (D:) Cytochrome c oxidase {Paracoccus denitrificans} tdhkhgemdirhqqatfagfikgatwvsilsiavlvflalans
Timeline for d1qled1: