Lineage for d1qled_ (1qle D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025589Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) (S)
    automatically mapped to Pfam PF07835
  5. 3025590Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (2 proteins)
  6. 3025591Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species)
    interacts with subunit I and III, function unknown, non-essential for the enzymatic activity
  7. 3025592Species Paracoccus denitrificans [TaxId:266] [81465] (1 PDB entry)
  8. 3025593Domain d1qled_: 1qle D: [43623]
    Other proteins in same PDB: d1qlea_, d1qleb1, d1qleb2, d1qlec_, d1qleh_, d1qlel_
    complexed with ca, cu, cua, hea, mn, pc1

Details for d1qled_

PDB Entry: 1qle (more details), 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment
PDB Compounds: (D:) ccytochrome c oxidase

SCOPe Domain Sequences for d1qled_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qled_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Paracoccus denitrificans [TaxId: 266]}
tdhkhgemdirhqqatfagfikgatwvsilsiavlvflalans

SCOPe Domain Coordinates for d1qled_:

Click to download the PDB-style file with coordinates for d1qled_.
(The format of our PDB-style files is described here.)

Timeline for d1qled_: