Lineage for d1qleb2 (1qle B:1-107)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. Species Paracoccus denitrificans [TaxId:266] [81456] (4 PDB entries)
  8. Domain d1qleb2: 1qle B:1-107 [43621]
    Other proteins in same PDB: d1qlea_, d1qleb1, d1qlec_, d1qled_, d1qleh_, d1qlel_
    complexed with ca, cu, cua, hea, mn, pc1

Details for d1qleb2

PDB Entry: 1qle (more details), 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment
PDB Compounds: (B:) cytochrome c oxidase polypeptide II

SCOPe Domain Sequences for d1qleb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qleb2 f.17.2.1 (B:1-107) Bacterial aa3 type cytochrome c oxidase subunit II {Paracoccus denitrificans [TaxId: 266]}
qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf
nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp

SCOPe Domain Coordinates for d1qleb2 are not available.

Timeline for d1qleb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qleb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1qlea_, d1qlec_, d1qled_, d1qleh_, d1qlel_