Lineage for d1qleb2 (1qle B:1-107)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519697Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies)
    two antiparallel transmembrane helices
  4. 519719Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 519720Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 519721Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. 519722Species Paracoccus denitrificans [TaxId:266] [81456] (2 PDB entries)
  8. 519724Domain d1qleb2: 1qle B:1-107 [43621]
    Other proteins in same PDB: d1qlea_, d1qleb1, d1qlec_, d1qled_, d1qleh_, d1qlel_

Details for d1qleb2

PDB Entry: 1qle (more details), 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

SCOP Domain Sequences for d1qleb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qleb2 f.17.2.1 (B:1-107) Bacterial aa3 type cytochrome c oxidase subunit II {Paracoccus denitrificans}
qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf
nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp

SCOP Domain Coordinates for d1qleb2:

Click to download the PDB-style file with coordinates for d1qleb2.
(The format of our PDB-style files is described here.)

Timeline for d1qleb2: